PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco003018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 248aa    MW: 28006.8 Da    PI: 7.5387
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco003018.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.17.4e-261059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 ri++   rqvtfskRrng+lKKA+EL +LCdaev +i+fsstg+ly+++s
  Aco003018.1 10 RIDDAASRQVTFSKRRNGLLKKAKELAILCDAEVGLIVFSSTGRLYDFAS 59
                 89**********************************************86 PP

2K-box79.11.1e-2681170998
        K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  ++ ++ + ++ e+  L+++++nLq+++R+llGe+L+ L +k+Lq Le+qLe sl+ +R +K+++l +qi+el +k   +++en++L k++
  Aco003018.1  81 NAISEVKFWRGEAGSLRQQLHNLQESHRQLLGEELSGLGVKDLQVLENQLEMSLRGVRVQKDQILANQIQELNRKGSLIHQENMELYKEV 170
                  5668899*******************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.469161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-30276IPR002100Transcription factor, MADS-box
CDDcd002652.47E-43276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-27323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-273859IPR002100Transcription factor, MADS-box
PfamPF014863.3E-2684170IPR002487Transcription factor, K-box
PROSITE profilePS5129714.79586176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGRGKIAIRR IDDAASRQVT FSKRRNGLLK KAKELAILCD AEVGLIVFSS TGRLYDFASS  60
SLKSVIERYH KTKEESCLVM NAISEVKFWR GEAGSLRQQL HNLQESHRQL LGEELSGLGV  120
KDLQVLENQL EMSLRGVRVQ KDQILANQIQ ELNRKGSLIH QENMELYKEV NIMCQENMEL  180
HRKVHETSGE NDDNRGTVVS YTFHMTDYTN APLYLELSQP QQQADGVQSG APNLRCRLEL  240
SATTCNN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-19174174Myocyte-specific enhancer factor 2B
1tqe_Q1e-19174174Myocyte-specific enhancer factor 2B
1tqe_R1e-19174174Myocyte-specific enhancer factor 2B
1tqe_S1e-19174174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008800745.11e-124PREDICTED: MADS-box transcription factor 23-like
SwissprotQ6EP491e-110MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLM0SCJ81e-122M0SCJ8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P07310_0011e-121(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61435130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.11e-101AGAMOUS-like 16